| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.4: Parvalbumin [47492] (3 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
| Protein Parvalbumin [47495] (9 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [158476] (6 PDB entries) |
| Domain d3f45a_: 3f45 A: [175449] automated match to d1rtp1_ complexed with ca, so4; mutant |
PDB Entry: 3f45 (more details), 2 Å
SCOPe Domain Sequences for d3f45a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f45a_ a.39.1.4 (A:) Parvalbumin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdaadlsaketktlmaagdkdgdgkigveefstlvaes
Timeline for d3f45a_: