Lineage for d3f3yb_ (3f3y B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845738Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 1845785Protein Hydroxysteroid sulfotransferase sult2a1 [52578] (1 species)
  7. 1845786Species Human (Homo sapiens) [TaxId:9606] [52579] (6 PDB entries)
  8. 1845791Domain d3f3yb_: 3f3y B: [175446]
    automated match to d1j99a_
    complexed with 4oa, a3p

Details for d3f3yb_

PDB Entry: 3f3y (more details), 2.2 Å

PDB Description: Crystal structure of human cytosolic sulfotransferase SULT2A1 in complex with PAP and lithocholic acid
PDB Compounds: (B:) Bile salt sulfotransferase

SCOPe Domain Sequences for d3f3yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f3yb_ c.37.1.5 (B:) Hydroxysteroid sulfotransferase sult2a1 {Human (Homo sapiens) [TaxId: 9606]}
dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
qllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe

SCOPe Domain Coordinates for d3f3yb_:

Click to download the PDB-style file with coordinates for d3f3yb_.
(The format of our PDB-style files is described here.)

Timeline for d3f3yb_: