SCOPe 2.03: Domain d3f3ma_: 3f3m A:

Lineage for d3f3ma_ (3f3m A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (31 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [189083] (1 PDB entry)

8. Domain d3f3ma_: 3f3m A: [175444]
   automated match to d1o6ba_
   complexed with pps

Details for d3f3ma_

PDB Entry: 3f3m, 2.4 Å

PDB Description: Six Crystal Structures of Two Phosphopantetheine Adenylyltransferases Reveal an Alternative Ligand Binding Mode and an Associated Structural Change

PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3f3ma_:

Sequence, based on SEQRES records:

>d3f3ma_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv
khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm
sstnysfisssivkevaayradisefvppyvekalkkkfk

Sequence, based on observed residues (ATOM records):

>d3f3ma_ c.26.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlkgtfsleermdlieqsvkhlpn
vkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymmsstny
sfisssivkevaayradisefvppyvekalkkkfk

Timeline for d3f3ma_:

• d3f3ma_ first appeared in SCOPe 2.01
  
• d3f3ma_ appears in SCOPe 2.02
  
• d3f3ma_ appears in SCOPe 2.04
  
• d3f3ma_ appears in the current release, SCOPe 2.08