Lineage for d3f3hb_ (3f3h B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766639Superfamily b.1.21: Fungal immunomodulatory protein, FIP [101542] (1 family) (S)
    automatically mapped to Pfam PF09259
  5. 2766640Family b.1.21.1: Fungal immunomodulatory protein, FIP [101543] (2 proteins)
  6. 2766645Protein automated matches [191068] (2 species)
    not a true protein
  7. 2766646Species Ganoderma lucidum [TaxId:5315] [188973] (1 PDB entry)
  8. 2766648Domain d3f3hb_: 3f3h B: [175443]
    automated match to d1osya_

Details for d3f3hb_

PDB Entry: 3f3h (more details), 2.1 Å

PDB Description: Crystal structure and anti-tumor activity of LZ-8 from the fungus Ganoderma lucidium
PDB Compounds: (B:) Immunomodulatory protein Ling Zhi-8

SCOPe Domain Sequences for d3f3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f3hb_ b.1.21.1 (B:) automated matches {Ganoderma lucidum [TaxId: 5315]}
dtalifrlawdvkklsfdytpnwgrgnpnnfidtvtfpkvltdkaytyrvavsgrnlgvk
psyavesdgsqkvnfleynsgygiadtntiqvfvvdpdtnndfiiaqwn

SCOPe Domain Coordinates for d3f3hb_:

Click to download the PDB-style file with coordinates for d3f3hb_.
(The format of our PDB-style files is described here.)

Timeline for d3f3hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3f3ha_