SCOPe 2.08: Domain d3f3hb_: 3f3h B:

Lineage for d3f3hb_ (3f3h B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.21: Fungal immunomodulatory protein, FIP [101542] (1 family)
   automatically mapped to Pfam PF09259

5. Family b.1.21.1: Fungal immunomodulatory protein, FIP [101543] (2 proteins)

6. Protein automated matches [191068] (2 species)
   not a true protein

7. Species Ganoderma lucidum [TaxId:5315] [188973] (1 PDB entry)

8. Domain d3f3hb_: 3f3h B: [175443]
   automated match to d1osya_

Details for d3f3hb_

PDB Entry: 3f3h, 2.1 Å

PDB Description: Crystal structure and anti-tumor activity of LZ-8 from the fungus Ganoderma lucidium

PDB Compounds: (B:) Immunomodulatory protein Ling Zhi-8

SCOPe Domain Sequences for d3f3hb_:

Sequence; same for both SEQRES and ATOM records:

>d3f3hb_ b.1.21.1 (B:) automated matches {Ganoderma lucidum [TaxId: 5315]}
dtalifrlawdvkklsfdytpnwgrgnpnnfidtvtfpkvltdkaytyrvavsgrnlgvk
psyavesdgsqkvnfleynsgygiadtntiqvfvvdpdtnndfiiaqwn

Timeline for d3f3hb_:

• d3f3hb_ first appeared in SCOPe 2.01
  
• d3f3hb_ appears in SCOPe 2.07