| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.1: Spectrin repeat [46966] (2 families) ![]() |
| Family a.7.1.0: automated matches [191601] (1 protein) not a true family |
| Protein automated matches [191094] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189074] (2 PDB entries) |
| Domain d3f31b_: 3f31 B: [175429] automated match to d1owaa_ |
PDB Entry: 3f31 (more details), 2.3 Å
SCOPe Domain Sequences for d3f31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f31b_ a.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vletaediqerrqqvldryhrfkelstlrrqkledsyrfqffqrdaeelekwiqeklqia
sdenykdptnlqgklqkhqafeaevqansgaivkldetgnlmiseghfasetirtrlmel
hrqwelllekmrekgikllq
Timeline for d3f31b_: