SCOPe 2.08: Domain d3f31a_: 3f31 A:

Lineage for d3f31a_ (3f31 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (2 families)

5. Family a.7.1.0: automated matches [191601] (1 protein)
   not a true family

6. Protein automated matches [191094] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189074] (2 PDB entries)

8. Domain d3f31a_: 3f31 A: [175428]
   automated match to d1owaa_

Details for d3f31a_

PDB Entry: 3f31, 2.3 Å

PDB Description: crystal structure of the n-terminal region of alphaii-spectrin tetramerization domain

PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d3f31a_:

Sequence; same for both SEQRES and ATOM records:

>d3f31a_ a.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
taediqerrqqvldryhrfkelstlrrqkledsyrfqffqrdaeelekwiqeklqiasde
nykdptnlqgklqkhqafeaevqansgaivkldetgnlmiseghfasetirtrlmelhrq
welllekmrekgikllq

Timeline for d3f31a_:

• d3f31a_ first appeared in SCOPe 2.01
  
• d3f31a_ appears in SCOPe 2.07