Lineage for d3f2la_ (3f2l A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040342Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2040356Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2040439Protein automated matches [190248] (6 species)
    not a true protein
  7. 2040440Species Acetivibrio cellulolyticus [TaxId:35830] [188707] (1 PDB entry)
  8. 2040441Domain d3f2la_: 3f2l A: [175427]
    automated match to d1qzna_
    complexed with edo, nh4, no3; mutant

Details for d3f2la_

PDB Entry: 3f2l (more details), 1.85 Å

PDB Description: crystal structure analysis of the k171a mutation of n-terminal type ii cohesin 1 from the cellulosomal scab subunit of acetivibrio cellulolyticus
PDB Compounds: (A:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d3f2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f2la_ b.2.2.2 (A:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
aptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytks
tmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvl
keetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmiaa

SCOPe Domain Coordinates for d3f2la_:

Click to download the PDB-style file with coordinates for d3f2la_.
(The format of our PDB-style files is described here.)

Timeline for d3f2la_: