SCOPe 2.06: Domain d3f2la_: 3f2l A:

Lineage for d3f2la_ (3f2l A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein automated matches [190248] (6 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [188707] (1 PDB entry)

8. Domain d3f2la_: 3f2l A: [175427]
   automated match to d1qzna_
   complexed with edo, nh4, no3; mutant

Details for d3f2la_

PDB Entry: 3f2l, 1.85 Å

PDB Description: crystal structure analysis of the k171a mutation of n-terminal type ii cohesin 1 from the cellulosomal scab subunit of acetivibrio cellulolyticus

PDB Compounds: (A:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d3f2la_:

Sequence; same for both SEQRES and ATOM records:

>d3f2la_ b.2.2.2 (A:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
aptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytks
tmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvl
keetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmiaa

Timeline for d3f2la_:

• d3f2la_ first appeared in SCOPe 2.01
  
• d3f2la_ appears in SCOPe 2.05
  
• d3f2la_ appears in SCOPe 2.07
  
• d3f2la_ appears in the current release, SCOPe 2.08