Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein automated matches [190248] (6 species) not a true protein |
Species Acetivibrio cellulolyticus [TaxId:35830] [188707] (3 PDB entries) |
Domain d3f2la_: 3f2l A: [175427] automated match to d1qzna_ complexed with edo, nh4, no3; mutant |
PDB Entry: 3f2l (more details), 1.85 Å
SCOPe Domain Sequences for d3f2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f2la_ b.2.2.2 (A:) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]} aptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytks tmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvl keetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmiaa
Timeline for d3f2la_: