![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
![]() | Family a.21.1.1: HMG-box [47096] (10 proteins) |
![]() | Protein automated matches [190434] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188832] (3 PDB entries) |
![]() | Domain d3f27d_: 3f27 D: [175425] automated match to d1gt0d_ protein/DNA complex |
PDB Entry: 3f27 (more details), 2.75 Å
SCOPe Domain Sequences for d3f27d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f27d_ a.21.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} irrpmnafmvwakderkrlaqqnpdlhnaelskmlgkswkaltlaekrpfveeaerlrvq hmqdhpnykyrprr
Timeline for d3f27d_: