Lineage for d3f23c_ (3f23 C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259114Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 1259125Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)
  7. 1259126Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries)
  8. 1259141Domain d3f23c_: 3f23 C: [175424]
    automated match to d1qgpa_
    protein/DNA complex; protein/RNA complex

Details for d3f23c_

PDB Entry: 3f23 (more details), 2.7 Å

PDB Description: Crystal structure of Zalpha in complex with d(CGGCCG)
PDB Compounds: (C:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d3f23c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f23c_ a.4.5.19 (C:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}
siyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpp
lwkiav

SCOPe Domain Coordinates for d3f23c_:

Click to download the PDB-style file with coordinates for d3f23c_.
(The format of our PDB-style files is described here.)

Timeline for d3f23c_: