Lineage for d3f21c_ (3f21 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693367Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 2693378Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)
  7. 2693379Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries)
  8. 2693388Domain d3f21c_: 3f21 C: [175418]
    automated match to d1qgpa_
    protein/DNA complex; protein/RNA complex

Details for d3f21c_

PDB Entry: 3f21 (more details), 2.2 Å

PDB Description: Crystal structure of Zalpha in complex with d(CACGTG)
PDB Compounds: (C:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d3f21c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f21c_ a.4.5.19 (C:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}
siyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpp
lwki

SCOPe Domain Coordinates for d3f21c_:

Click to download the PDB-style file with coordinates for d3f21c_.
(The format of our PDB-style files is described here.)

Timeline for d3f21c_: