Lineage for d3f1pb_ (3f1p B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970710Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries)
  8. 2970713Domain d3f1pb_: 3f1p B: [175414]
    Other proteins in same PDB: d3f1pa1, d3f1pa2
    automated match to d1p97a_

Details for d3f1pb_

PDB Entry: 3f1p (more details), 1.17 Å

PDB Description: crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains
PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d3f1pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f1pb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv
klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns

SCOPe Domain Coordinates for d3f1pb_:

Click to download the PDB-style file with coordinates for d3f1pb_.
(The format of our PDB-style files is described here.)

Timeline for d3f1pb_: