![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries) |
![]() | Domain d3f1pb_: 3f1p B: [175414] Other proteins in same PDB: d3f1pa1, d3f1pa2 automated match to d1p97a_ |
PDB Entry: 3f1p (more details), 1.17 Å
SCOPe Domain Sequences for d3f1pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f1pb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns
Timeline for d3f1pb_: