| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
| Protein automated matches [190492] (20 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187434] (22 PDB entries) |
| Domain d3f1ob_: 3f1o B: [175412] Other proteins in same PDB: d3f1oa1, d3f1oa2 automated match to d1p97a_ complexed with 2xy, edo |
PDB Entry: 3f1o (more details), 1.6 Å
SCOPe Domain Sequences for d3f1ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f1ob_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv
klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknss
Timeline for d3f1ob_: