Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins) contains PAC motif |
Protein automated matches [191006] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188753] (8 PDB entries) |
Domain d3f1na_: 3f1n A: [175409] Other proteins in same PDB: d3f1nb_ automated match to d1p97a_ complexed with edo |
PDB Entry: 3f1n (more details), 1.48 Å
SCOPe Domain Sequences for d3f1na_:
Sequence, based on SEQRES records: (download)
>d3f1na_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn lctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek
>d3f1na_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn lctkgqvvsgqyrmlakhggyvwletqgtviypqcimcvnyvlseiek
Timeline for d3f1na_: