Lineage for d3f1ca1 (3f1c A:2-234)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899362Species Listeria monocytogenes [TaxId:265669] [188669] (1 PDB entry)
  8. 2899363Domain d3f1ca1: 3f1c A:2-234 [175404]
    Other proteins in same PDB: d3f1ca2, d3f1cb2
    automated match to d1vpaa_

Details for d3f1ca1

PDB Entry: 3f1c (more details), 2.3 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase from listeria monocytogenes
PDB Compounds: (A:) Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2

SCOPe Domain Sequences for d3f1ca1:

Sequence, based on SEQRES records: (download)

>d3f1ca1 c.68.1.0 (A:2-234) automated matches {Listeria monocytogenes [TaxId: 265669]}
iyaqilaggkgtrmgnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnha
ednikkyisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthrii
eenidaaletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyq
nltpekkqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri

Sequence, based on observed residues (ATOM records): (download)

>d3f1ca1 c.68.1.0 (A:2-234) automated matches {Listeria monocytogenes [TaxId: 265669]}
iyaqilagmnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnhaednikk
yisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthriieenida
aletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyqnltpek
kqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri

SCOPe Domain Coordinates for d3f1ca1:

Click to download the PDB-style file with coordinates for d3f1ca1.
(The format of our PDB-style files is described here.)

Timeline for d3f1ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f1ca2