![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:265669] [188669] (1 PDB entry) |
![]() | Domain d3f1ca1: 3f1c A:2-234 [175404] Other proteins in same PDB: d3f1ca2, d3f1cb2 automated match to d1vpaa_ |
PDB Entry: 3f1c (more details), 2.3 Å
SCOPe Domain Sequences for d3f1ca1:
Sequence, based on SEQRES records: (download)
>d3f1ca1 c.68.1.0 (A:2-234) automated matches {Listeria monocytogenes [TaxId: 265669]} iyaqilaggkgtrmgnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnha ednikkyisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthrii eenidaaletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyq nltpekkqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri
>d3f1ca1 c.68.1.0 (A:2-234) automated matches {Listeria monocytogenes [TaxId: 265669]} iyaqilagmnvsmpkqflplngkpiivhtvekfilntrfdkilisspkewmnhaednikk yisddrivvieggedrnetimngirfvektygltdddiivthdavrpflthriieenida aletgavdtviealdtivessnhevitdipvrdhmyqgqtpqsfnmkkvfnhyqnltpek kqiltdackicllagddvklvkgeifnikittpydlkvanaiiqeri
Timeline for d3f1ca1: