Lineage for d3f17a_ (3f17 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1918283Protein automated matches [190182] (1 species)
    not a true protein
  7. 1918284Species Human (Homo sapiens) [TaxId:9606] [186920] (32 PDB entries)
  8. 1918285Domain d3f17a_: 3f17 A: [175400]
    automated match to d1os2a_
    complexed with ca, hs4, zn

Details for d3f17a_

PDB Entry: 3f17 (more details), 1.1 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-(2-nitroso-2-oxoethyl)biphenyl-4-sulfonamide
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3f17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f17a_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d3f17a_:

Click to download the PDB-style file with coordinates for d3f17a_.
(The format of our PDB-style files is described here.)

Timeline for d3f17a_: