Lineage for d3f15a_ (3f15 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964641Protein automated matches [190182] (1 species)
    not a true protein
  7. 2964642Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2964667Domain d3f15a_: 3f15 A: [175398]
    automated match to d1os2a_
    complexed with ca, hs1, zn

Details for d3f15a_

PDB Entry: 3f15 (more details), 1.7 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor (s)-n-(2,3-dihydroxypropyl)-4-methoxy-n-(2- nitroso-2-oxoethyl)benzenesulfonamide
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3f15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f15a_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d3f15a_:

Click to download the PDB-style file with coordinates for d3f15a_.
(The format of our PDB-style files is described here.)

Timeline for d3f15a_: