Lineage for d3f11a_ (3f11 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164310Species Synechocystis sp. PCC 6803 [TaxId:1148] [187344] (3 PDB entries)
  8. 2164312Domain d3f11a_: 3f11 A: [175397]
    automated match to d1y4ta_
    complexed with edo, fe, so4

Details for d3f11a_

PDB Entry: 3f11 (more details), 2 Å

PDB Description: Structure of futa1 with iron(III)
PDB Compounds: (A:) Iron transport protein

SCOPe Domain Sequences for d3f11a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f11a_ c.94.1.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qeinlyssrhyntdnelyakftaetgikvnliegkadellerikseganspadvlltvdl
arlwraeedgifqpvqseiletnvpeylrspdgmwfgftkrarvimynkgkvkpeelsty
eeladpkwkgrviirsssneynqslvaslvvadgeestlawakgfvsnfarepqgndtaq
ieavssgeadltlantyymgrllesedpaqkaiaenvgvffpnqegrgthvnvsgvgvvk
tapnregavkfieflvsepaqaflaqnnyeypvlagvplnksvasfgefksdttsldklg
palapatkimneagwk

SCOPe Domain Coordinates for d3f11a_:

Click to download the PDB-style file with coordinates for d3f11a_.
(The format of our PDB-style files is described here.)

Timeline for d3f11a_: