SCOPe 2.06: Domain d3f11a_: 3f11 A:

Lineage for d3f11a_ (3f11 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [187344] (3 PDB entries)

8. Domain d3f11a_: 3f11 A: [175397]
   automated match to d1y4ta_
   complexed with edo, fe, so4

Details for d3f11a_

PDB Entry: 3f11, 2 Å

PDB Description: Structure of futa1 with iron(III)

PDB Compounds: (A:) Iron transport protein

SCOPe Domain Sequences for d3f11a_:

Sequence; same for both SEQRES and ATOM records:

>d3f11a_ c.94.1.0 (A:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qeinlyssrhyntdnelyakftaetgikvnliegkadellerikseganspadvlltvdl
arlwraeedgifqpvqseiletnvpeylrspdgmwfgftkrarvimynkgkvkpeelsty
eeladpkwkgrviirsssneynqslvaslvvadgeestlawakgfvsnfarepqgndtaq
ieavssgeadltlantyymgrllesedpaqkaiaenvgvffpnqegrgthvnvsgvgvvk
tapnregavkfieflvsepaqaflaqnnyeypvlagvplnksvasfgefksdttsldklg
palapatkimneagwk

Timeline for d3f11a_:

• d3f11a_ first appeared in SCOPe 2.01
  
• d3f11a_ appears in SCOPe 2.05
  
• d3f11a_ appears in SCOPe 2.07
  
• d3f11a_ appears in the current release, SCOPe 2.08