Lineage for d3f0yi_ (3f0y I:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943014Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 943015Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 943016Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
  6. 943057Protein automated matches [190333] (3 species)
    not a true protein
  7. 943088Species Human adenovirus 14 [TaxId:10521] [188677] (1 PDB entry)
  8. 943097Domain d3f0yi_: 3f0y I: [175396]
    automated match to d2o39a1
    complexed with gol, imd

Details for d3f0yi_

PDB Entry: 3f0y (more details), 1.8 Å

PDB Description: Crystal structure of the human Adenovirus type 14 fiber knob
PDB Compounds: (I:) fiber protein

SCOPe Domain Sequences for d3f0yi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0yi_ b.21.1.1 (I:) automated matches {Human adenovirus 14 [TaxId: 10521]}
ddnintlwtgvnpteancqmmdssesndckliltlvktgalvtafvyvigvsnnfnmltt
yrninftaelffdsagnlltslsslktplnhksgqnmatgaitnaksfmpsttaypfnnn
srekenyiygtchytasdhtafpidisvmlnqrairadtsyciritwswntgdapegqts
attlvtspftfyyiredd

SCOPe Domain Coordinates for d3f0yi_:

Click to download the PDB-style file with coordinates for d3f0yi_.
(The format of our PDB-style files is described here.)

Timeline for d3f0yi_: