Class b: All beta proteins [48724] (176 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein automated matches [190333] (4 species) not a true protein |
Species Human adenovirus 14 [TaxId:10521] [188677] (1 PDB entry) |
Domain d3f0yc_: 3f0y C: [175390] automated match to d2o39a1 complexed with gol, imd |
PDB Entry: 3f0y (more details), 1.8 Å
SCOPe Domain Sequences for d3f0yc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f0yc_ b.21.1.1 (C:) automated matches {Human adenovirus 14 [TaxId: 10521]} ddnintlwtgvnpteancqmmdssesndckliltlvktgalvtafvyvigvsnnfnmltt yrninftaelffdsagnlltslsslktplnhksgqnmatgaitnaksfmpsttaypfnnn srekenyiygtchytasdhtafpidisvmlnqrairadtsyciritwswntgdapegqts attlvtspftfyyiredd
Timeline for d3f0yc_: