Lineage for d3f0sx_ (3f0s X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154171Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2154172Protein automated matches [190777] (21 species)
    not a true protein
  7. 2154393Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries)
  8. 2154406Domain d3f0sx_: 3f0s X: [175382]
    automated match to d1dhja_
    complexed with 53t, ndp

Details for d3f0sx_

PDB Entry: 3f0s (more details), 2.7 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with nadph and 2,4-diamino-5-[3-(3-methoxy-5-(3,5-dimethylphenyl)phenyl)but-1-ynyl]- 6-methylpyrimidine
PDB Compounds: (X:) Trimethoprim-sensitive dihydrofolate reductase

SCOPe Domain Sequences for d3f0sx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0sx_ c.71.1.0 (X:) automated matches {Staphylococcus aureus [TaxId: 273036]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3f0sx_:

Click to download the PDB-style file with coordinates for d3f0sx_.
(The format of our PDB-style files is described here.)

Timeline for d3f0sx_: