Lineage for d3f0rb1 (3f0r B:13-377)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874190Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2874235Protein automated matches [190786] (1 species)
    not a true protein
  7. 2874236Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries)
  8. 2874269Domain d3f0rb1: 3f0r B:13-377 [175380]
    Other proteins in same PDB: d3f0ra2, d3f0rb2
    automated match to d1t64a_
    complexed with k, tsn, zn

Details for d3f0rb1

PDB Entry: 3f0r (more details), 2.54 Å

PDB Description: Crystal Structure Analysis of Human HDAC8 complexed with trichostatin A in a new monoclinic crystal form
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d3f0rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0rb1 c.42.1.2 (B:13-377) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfht
daylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmck
vainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsft
skvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevy
qafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlanta
rcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgn
lkhvv

SCOPe Domain Coordinates for d3f0rb1:

Click to download the PDB-style file with coordinates for d3f0rb1.
(The format of our PDB-style files is described here.)

Timeline for d3f0rb1: