Lineage for d3f00a_ (3f00 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941314Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 941315Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 941391Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 941416Protein Synaptogamin I [49576] (2 species)
    duplication: contains tandem repeat of two similar domains
  7. 941417Species Human (Homo sapiens) [TaxId:9606] [158946] (5 PDB entries)
  8. 941419Domain d3f00a_: 3f00 A: [175368]
    automated match to d1byna_
    complexed with cu, so4

Details for d3f00a_

PDB Entry: 3f00 (more details), 1.36 Å

PDB Description: crystal structure of synaptotagmin i c2a domain with cu(ii)
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d3f00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f00a_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
gspgiggggggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvk
vfllpdkkkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiige
fkvpmntvdfghvteewrdlqsa

SCOPe Domain Coordinates for d3f00a_:

Click to download the PDB-style file with coordinates for d3f00a_.
(The format of our PDB-style files is described here.)

Timeline for d3f00a_: