Lineage for d3ezzf_ (3ezz F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875107Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2875165Protein automated matches [190696] (6 species)
    not a true protein
  7. 2875201Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries)
  8. 2875230Domain d3ezzf_: 3ezz F: [175367]
    automated match to d1m3ga_
    complexed with so4

Details for d3ezzf_

PDB Entry: 3ezz (more details), 2.9 Å

PDB Description: crystal structure of human mkp-2
PDB Compounds: (F:) Dual specificity protein phosphatase 4

SCOPe Domain Sequences for d3ezzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezzf_ c.45.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mggpveilpflylgsayhaarrdmldalgitallnvssdcpnhfeghyqykcipvednhk
adisswfmeaieyidavkdcrgrvlvhsqagisrsaticlaylmmkkrvrleeafefvkq
rrsiispnfsfmgqllqfesqvla

SCOPe Domain Coordinates for d3ezzf_:

Click to download the PDB-style file with coordinates for d3ezzf_.
(The format of our PDB-style files is described here.)

Timeline for d3ezzf_: