SCOPe 2.01: Domain d3ezzc_: 3ezz C:

Lineage for d3ezzc_ (3ezz C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188122] (5 PDB entries)

8. Domain d3ezzc_: 3ezz C: [175364]
   automated match to d1m3ga_
   complexed with so4

Details for d3ezzc_

PDB Entry: 3ezz, 2.9 Å

PDB Description: crystal structure of human mkp-2

PDB Compounds: (C:) Dual specificity protein phosphatase 4

SCOPe Domain Sequences for d3ezzc_:

Sequence; same for both SEQRES and ATOM records:

>d3ezzc_ c.45.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mggpveilpflylgsayhaarrdmldalgitallnvssdcpnhfeghyqykcipvednhk
adisswfmeaieyidavkdcrgrvlvhsqagisrsaticlaylmmkkrvrleeafefvkq
rrsiispnfsfmgqllqfesqvla

Timeline for d3ezzc_:

• d3ezzc_ is new in SCOPe 2.01-stable
  
• d3ezzc_ appears in SCOPe 2.02
  
• d3ezzc_ appears in the current release, SCOPe 2.08