SCOPe 2.05: Domain d3ezzb_: 3ezz B:

Lineage for d3ezzb_ (3ezz B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188122] (10 PDB entries)

8. Domain d3ezzb_: 3ezz B: [175363]
   automated match to d1m3ga_
   complexed with so4

Details for d3ezzb_

PDB Entry: 3ezz, 2.9 Å

PDB Description: crystal structure of human mkp-2

PDB Compounds: (B:) Dual specificity protein phosphatase 4

SCOPe Domain Sequences for d3ezzb_:

Sequence; same for both SEQRES and ATOM records:

>d3ezzb_ c.45.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mggpveilpflylgsayhaarrdmldalgitallnvssdcpnhfeghyqykcipvednhk
adisswfmeaieyidavkdcrgrvlvhsqagisrsaticlaylmmkkrvrleeafefvkq
rrsiispnfsfmgqllqfesqvla

Timeline for d3ezzb_:

• d3ezzb_ first appeared in SCOPe 2.01
  
• d3ezzb_ appears in SCOPe 2.04
  
• d3ezzb_ appears in SCOPe 2.06
  
• d3ezzb_ appears in the current release, SCOPe 2.08