SCOPe 2.06: Domain d3ezwg1: 3ezw G:1-253

Lineage for d3ezwg1 (3ezw G:1-253)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)

8. Domain d3ezwg1: 3ezw G:1-253 [175358]
   automated match to d1glfo1
   complexed with cl, edo, gol, mg; mutant

Details for d3ezwg1

PDB Entry: 3ezw, 2 Å

PDB Description: crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices

PDB Compounds: (G:) glycerol kinase

SCOPe Domain Sequences for d3ezwg1:

Sequence; same for both SEQRES and ATOM records:

>d3ezwg1 c.55.1.4 (G:1-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
vevlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtnidgkggtripis
giagdqqaalfgq

Timeline for d3ezwg1:

• d3ezwg1 first appeared in SCOPe 2.01
  
• d3ezwg1 appears in SCOPe 2.05
  
• d3ezwg1 appears in SCOPe 2.07
  
• d3ezwg1 appears in the current release, SCOPe 2.08