Lineage for d3ezwf2 (3ezw F:254-499)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372952Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1372953Protein Glycerol kinase [53090] (2 species)
  7. 1372995Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 1373007Domain d3ezwf2: 3ezw F:254-499 [175357]
    automatically matched to d1bu6x2
    complexed with cl, edo, gol, mg; mutant

Details for d3ezwf2

PDB Entry: 3ezw (more details), 2 Å

PDB Description: crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices
PDB Compounds: (F:) glycerol kinase

SCOPe Domain Sequences for d3ezwf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezwf2 c.55.1.4 (F:254-499) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOPe Domain Coordinates for d3ezwf2:

Click to download the PDB-style file with coordinates for d3ezwf2.
(The format of our PDB-style files is described here.)

Timeline for d3ezwf2: