Lineage for d3ezwe2 (3ezw E:254-499)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858084Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1858085Protein Glycerol kinase [53090] (2 species)
  7. 1858127Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 1858137Domain d3ezwe2: 3ezw E:254-499 [175355]
    automated match to d3ezwd2
    complexed with cl, edo, gol, mg; mutant

Details for d3ezwe2

PDB Entry: 3ezw (more details), 2 Å

PDB Description: crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices
PDB Compounds: (E:) glycerol kinase

SCOPe Domain Sequences for d3ezwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezwe2 c.55.1.4 (E:254-499) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOPe Domain Coordinates for d3ezwe2:

Click to download the PDB-style file with coordinates for d3ezwe2.
(The format of our PDB-style files is described here.)

Timeline for d3ezwe2: