| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
| Protein Glycerol kinase [53090] (2 species) |
| Species Escherichia coli [TaxId:562] [53091] (13 PDB entries) |
| Domain d3ezwb2: 3ezw B:254-500 [175349] automatically matched to d1bu6x2 complexed with cl, edo, gol, mg; mutant |
PDB Entry: 3ezw (more details), 2 Å
SCOPe Domain Sequences for d3ezwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezwb2 c.55.1.4 (B:254-500) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd
Timeline for d3ezwb2: