Lineage for d3ezsa_ (3ezs A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867580Species Helicobacter pylori [TaxId:85962] [188666] (2 PDB entries)
  8. 1867581Domain d3ezsa_: 3ezs A: [175341]
    automated match to d2gb3e1
    complexed with edo, po4

Details for d3ezsa_

PDB Entry: 3ezs (more details), 2.19 Å

PDB Description: crystal structure of aminotransferase aspb (np_207418.1) from helicobacter pylori 26695 at 2.19 a resolution
PDB Compounds: (A:) aminotransferase AspB

SCOPe Domain Sequences for d3ezsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezsa_ c.67.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
gmtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksaf
eeslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqi
yegaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswv
klalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrs
gfiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkif
kntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpl
lekpleiietyren

SCOPe Domain Coordinates for d3ezsa_:

Click to download the PDB-style file with coordinates for d3ezsa_.
(The format of our PDB-style files is described here.)

Timeline for d3ezsa_: