Lineage for d3ezsa1 (3ezs A:1-373)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897205Species Helicobacter pylori [TaxId:85962] [188666] (10 PDB entries)
  8. 2897210Domain d3ezsa1: 3ezs A:1-373 [175341]
    Other proteins in same PDB: d3ezsa2
    automated match to d2gb3e1
    complexed with edo, po4

Details for d3ezsa1

PDB Entry: 3ezs (more details), 2.19 Å

PDB Description: crystal structure of aminotransferase aspb (np_207418.1) from helicobacter pylori 26695 at 2.19 a resolution
PDB Compounds: (A:) aminotransferase AspB

SCOPe Domain Sequences for d3ezsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezsa1 c.67.1.0 (A:1-373) automated matches {Helicobacter pylori [TaxId: 85962]}
mtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksafe
eslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqiy
egaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswvk
lalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrsg
fiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkifk
ntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpll
ekpleiietyren

SCOPe Domain Coordinates for d3ezsa1:

Click to download the PDB-style file with coordinates for d3ezsa1.
(The format of our PDB-style files is described here.)

Timeline for d3ezsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ezsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ezsb_