![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [188666] (10 PDB entries) |
![]() | Domain d3ezsa1: 3ezs A:1-373 [175341] Other proteins in same PDB: d3ezsa2 automated match to d2gb3e1 complexed with edo, po4 |
PDB Entry: 3ezs (more details), 2.19 Å
SCOPe Domain Sequences for d3ezsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezsa1 c.67.1.0 (A:1-373) automated matches {Helicobacter pylori [TaxId: 85962]} mtfepypferlrallkeitpkkrgldlgigepqfetpkfiqdalknhthslniypksafe eslraaqrgffkrrfkielkenelistlgsrevlfnfpsfvlfdyqnptiaypnpfyqiy egaakfikaksllmpltkendftpslnekelqevdlvilnspnnptgrtlsleeliswvk lalkhdfilindecyseiyentpppslleacmlagneafknvlvihslskrssapglrsg fiagdsrllekykafraylgytsanaiqkaseaawlddrhaeffrniyannlklarkifk ntliypysfyvylpvqngenfaktlyqnegiitlpalylgrnrigadyvrlalvydtpll ekpleiietyren
Timeline for d3ezsa1: