Lineage for d3ezqm_ (3ezq M:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918821Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 918822Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 918823Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 918862Protein automated matches [190466] (2 species)
    not a true protein
  7. 918863Species Human (Homo sapiens) [TaxId:9606] [188706] (1 PDB entry)
  8. 918870Domain d3ezqm_: 3ezq M: [175338]
    automated match to d1ddfa_
    complexed with na, so4

Details for d3ezqm_

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (M:) Tumor necrosis factor receptor superfamily member 6

SCOPe Domain Sequences for d3ezqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezqm_ a.77.1.2 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle

SCOPe Domain Coordinates for d3ezqm_:

Click to download the PDB-style file with coordinates for d3ezqm_.
(The format of our PDB-style files is described here.)

Timeline for d3ezqm_: