SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ezqk1 (3ezq K:223-335)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001582Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2001583Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2001584Family a.77.1.2: DEATH domain, DD [81312] (9 protein domains)
    Pfam PF00531
  6. 2001631Protein automated matches [190466] (3 species)
    not a true protein
  7. 2001632Species Human (Homo sapiens) [TaxId:9606] [188706] (4 PDB entries)
  8. 2001638Domain d3ezqk1: 3ezq K:223-335 [175337]
    Other proteins in same PDB: d3ezqa2, d3ezqb_, d3ezqc2, d3ezqd_, d3ezqe2, d3ezqf_, d3ezqg2, d3ezqh_, d3ezqi2, d3ezqj_, d3ezqk2, d3ezql_, d3ezqm2, d3ezqn_, d3ezqo2, d3ezqp_
    automated match to d1ddfa_
    complexed with na, so4

Details for d3ezqk1

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (K:) Tumor necrosis factor receptor superfamily member 6

SCOPe Domain Sequences for d3ezqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezqk1 a.77.1.2 (K:223-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslv

SCOPe Domain Coordinates for d3ezqk1:

Click to download the PDB-style file with coordinates for d3ezqk1.
(The format of our PDB-style files is described here.)

Timeline for d3ezqk1: