Lineage for d3ezqk1 (3ezq K:223-335)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327294Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2327295Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2327296Family a.77.1.2: DEATH domain, DD [81312] (9 protein domains)
    Pfam PF00531
  6. 2327343Protein automated matches [190466] (3 species)
    not a true protein
  7. 2327344Species Human (Homo sapiens) [TaxId:9606] [188706] (4 PDB entries)
  8. 2327350Domain d3ezqk1: 3ezq K:223-335 [175337]
    Other proteins in same PDB: d3ezqa2, d3ezqb_, d3ezqc2, d3ezqd_, d3ezqe2, d3ezqf_, d3ezqg2, d3ezqh_, d3ezqi2, d3ezqj_, d3ezqk2, d3ezql_, d3ezqm2, d3ezqn_, d3ezqo2, d3ezqp_
    automated match to d1ddfa_
    complexed with na, so4

Details for d3ezqk1

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (K:) Tumor necrosis factor receptor superfamily member 6

SCOPe Domain Sequences for d3ezqk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezqk1 a.77.1.2 (K:223-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslv

SCOPe Domain Coordinates for d3ezqk1:

Click to download the PDB-style file with coordinates for d3ezqk1.
(The format of our PDB-style files is described here.)

Timeline for d3ezqk1: