Lineage for d3ezqg1 (3ezq G:223-335)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2718932Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2718979Protein automated matches [190466] (3 species)
    not a true protein
  7. 2718980Species Human (Homo sapiens) [TaxId:9606] [188706] (6 PDB entries)
  8. 2718985Domain d3ezqg1: 3ezq G:223-335 [175335]
    Other proteins in same PDB: d3ezqa2, d3ezqb_, d3ezqc2, d3ezqd_, d3ezqe2, d3ezqf_, d3ezqg2, d3ezqh_, d3ezqi2, d3ezqj_, d3ezqk2, d3ezql_, d3ezqm2, d3ezqn_, d3ezqo2, d3ezqp_
    automated match to d1ddfa_
    complexed with na, so4

Details for d3ezqg1

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (G:) Tumor necrosis factor receptor superfamily member 6

SCOPe Domain Sequences for d3ezqg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezqg1 a.77.1.2 (G:223-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslv

SCOPe Domain Coordinates for d3ezqg1:

Click to download the PDB-style file with coordinates for d3ezqg1.
(The format of our PDB-style files is described here.)

Timeline for d3ezqg1: