![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
![]() | Protein automated matches [190466] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188706] (4 PDB entries) |
![]() | Domain d3ezqa_: 3ezq A: [175332] Other proteins in same PDB: d3ezqb_, d3ezqd_, d3ezqf_, d3ezqh_, d3ezqj_, d3ezql_, d3ezqn_, d3ezqp_ automated match to d1ddfa_ complexed with na, so4 |
PDB Entry: 3ezq (more details), 2.73 Å
SCOPe Domain Sequences for d3ezqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezqa_ a.77.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle
Timeline for d3ezqa_: