Lineage for d3ezqa_ (3ezq A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496135Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 1496136Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 1496137Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 1496184Protein automated matches [190466] (3 species)
    not a true protein
  7. 1496185Species Human (Homo sapiens) [TaxId:9606] [188706] (1 PDB entry)
  8. 1496186Domain d3ezqa_: 3ezq A: [175332]
    Other proteins in same PDB: d3ezqb_, d3ezqd_, d3ezqf_, d3ezqh_, d3ezqj_, d3ezql_, d3ezqn_, d3ezqp_
    automated match to d1ddfa_
    complexed with na, so4

Details for d3ezqa_

PDB Entry: 3ezq (more details), 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex
PDB Compounds: (A:) Tumor necrosis factor receptor superfamily member 6

SCOPe Domain Sequences for d3ezqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezqa_ a.77.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslvle

SCOPe Domain Coordinates for d3ezqa_:

Click to download the PDB-style file with coordinates for d3ezqa_.
(The format of our PDB-style files is described here.)

Timeline for d3ezqa_: