Lineage for d3ezjh_ (3ezj H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513029Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)
  8. 1513137Domain d3ezjh_: 3ezj H: [175326]
    automated match to d1ol0a_
    complexed with cl, po4

Details for d3ezjh_

PDB Entry: 3ezj (more details), 2.8 Å

PDB Description: crystal structure of the n-terminal domain of the secretin gspd from etec determined with the assistance of a nanobody
PDB Compounds: (H:) nanobody nbgspd_7

SCOPe Domain Sequences for d3ezjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezjh_ b.1.1.1 (H:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss

SCOPe Domain Coordinates for d3ezjh_:

Click to download the PDB-style file with coordinates for d3ezjh_.
(The format of our PDB-style files is described here.)

Timeline for d3ezjh_: