Lineage for d3ezjb_ (3ezj B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758317Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)
  8. 1758443Domain d3ezjb_: 3ezj B: [175323]
    automated match to d1ol0a_
    complexed with cl, po4

Details for d3ezjb_

PDB Entry: 3ezj (more details), 2.8 Å

PDB Description: crystal structure of the n-terminal domain of the secretin gspd from etec determined with the assistance of a nanobody
PDB Compounds: (B:) nanobody nbgspd_7

SCOPe Domain Sequences for d3ezjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezjb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlqesggglvqaggslrlscaasgsifsinsmdwdrqapgkqrelvatitsggstnya
dsvkgrftisrdnakntvylqmnslkpedtavyycnanvktwagmtrdywgqgtqvtvss

SCOPe Domain Coordinates for d3ezjb_:

Click to download the PDB-style file with coordinates for d3ezjb_.
(The format of our PDB-style files is described here.)

Timeline for d3ezjb_: