Lineage for d3ez4j_ (3ez4 J:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1344393Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1344656Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins)
    automatically mapped to Pfam PF02548
  6. 1344686Protein automated matches [190978] (2 species)
    not a true protein
  7. 1344687Species Burkholderia pseudomallei [TaxId:28450] [188655] (1 PDB entry)
  8. 1344697Domain d3ez4j_: 3ez4 J: [175321]
    automated match to d1o68b_
    complexed with trs

Details for d3ez4j_

PDB Entry: 3ez4 (more details), 2.1 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei
PDB Compounds: (J:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOPe Domain Sequences for d3ez4j_:

Sequence, based on SEQRES records: (download)

>d3ez4j_ c.1.12.8 (J:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
hmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvt
lddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlae
tvrflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeagaqlivle
avptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsif
aaveayvravkdgsfpgpehsf

Sequence, based on observed residues (ATOM records): (download)

>d3ez4j_ c.1.12.8 (J:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
hmvtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvt
lddiayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlae
tvrflveravpvcahvgagaaqllrdaraveeagaqlivleavptlvaaevtrelsipti
gigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpe
hsf

SCOPe Domain Coordinates for d3ez4j_:

Click to download the PDB-style file with coordinates for d3ez4j_.
(The format of our PDB-style files is described here.)

Timeline for d3ez4j_: