Lineage for d3ez4e1 (3ez4 E:2-261)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088296Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 protein domains)
    automatically mapped to Pfam PF02548
  6. 2088326Protein automated matches [190978] (2 species)
    not a true protein
  7. 2088327Species Burkholderia pseudomallei [TaxId:28450] [188655] (1 PDB entry)
  8. 2088332Domain d3ez4e1: 3ez4 E:2-261 [175316]
    Other proteins in same PDB: d3ez4a2, d3ez4b2, d3ez4c2, d3ez4d2, d3ez4e2, d3ez4f2, d3ez4g2, d3ez4h2, d3ez4i2, d3ez4j2
    automated match to d1o68b_
    complexed with trs

Details for d3ez4e1

PDB Entry: 3ez4 (more details), 2.1 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei
PDB Compounds: (E:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOPe Domain Sequences for d3ez4e1:

Sequence, based on SEQRES records: (download)

>d3ez4e1 c.1.12.8 (E:2-261) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
vtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvtld
diayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlaetv
rflveravpvcahvgltpqsvhafggfkvqgkteagaaqllrdaraveeagaqlivleav
ptlvaaevtrelsiptigigagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaa
veayvravkdgsfpgpehsf

Sequence, based on observed residues (ATOM records): (download)

>d3ez4e1 c.1.12.8 (E:2-261) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
vtvpklqamreagekiamltsydasfaalldranvdvqligdslgnvlqgqattlpvtld
diayhtacvaraqprglvvadlpfgtygtpadafasavklmragaqmvkleggewlaetv
rflveravpvcahvgagaaqllrdaraveeagaqlivleavptlvaaevtrelsiptigi
gagaecsgqvlvlhdmlgvfpgkrprfvkdfmqgqpsifaaveayvravkdgsfpgpehs
f

SCOPe Domain Coordinates for d3ez4e1:

Click to download the PDB-style file with coordinates for d3ez4e1.
(The format of our PDB-style files is described here.)

Timeline for d3ez4e1: