SCOPe 2.06: Domain d3eyea_: 3eye A:

Lineage for d3eyea_ (3eye A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.38: PTS IIb component [52727] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156

4. Superfamily c.38.1: PTS IIb component [52728] (2 families)

5. Family c.38.1.0: automated matches [191563] (1 protein)
   not a true family

6. Protein automated matches [190977] (5 species)
   not a true protein

7. Species Escherichia coli O157:H7 [TaxId:83334] [188653] (1 PDB entry)

8. Domain d3eyea_: 3eye A: [175309]
   automated match to d1nrza_

Details for d3eyea_

PDB Entry: 3eye, 1.45 Å

PDB Description: crystal structure of pts system n-acetylgalactosamine-specific iib component 1 from escherichia coli

PDB Compounds: (A:) PTS system N-acetylgalactosamine-specific IIB component 1

SCOPe Domain Sequences for d3eyea_:

Sequence; same for both SEQRES and ATOM records:

>d3eyea_ c.38.1.0 (A:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]}
nilltridnrlvhgqvgvtwtstiganllvvvddvvanddiqqklmgitaetygfgirff
tiektinvigkaaphqkiflicrtpqtvrklveggidlkdvnvgnmhfsegkkqisskvy
vddqdltdlrfikqrgvnvfiqdvpgdqkeqip

Timeline for d3eyea_:

• d3eyea_ first appeared in SCOPe 2.01
  
• d3eyea_ appears in SCOPe 2.05
  
• d3eyea_ appears in SCOPe 2.07
  
• d3eyea_ appears in the current release, SCOPe 2.08