Lineage for d3eycd_ (3eyc D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 958304Protein Von Ebner's gland protein (VEGP, tear lipocalin) [117265] (1 species)
  7. 958305Species Human (Homo sapiens) [TaxId:9606] [117266] (2 PDB entries)
    Uniprot P31025 30-168
  8. 958310Domain d3eycd_: 3eyc D: [175308]
    automated match to d1xkia_
    complexed with bu1

Details for d3eycd_

PDB Entry: 3eyc (more details), 2.6 Å

PDB Description: new crystal structure of human tear lipocalin in complex with 1,4- butanediol in space group p21
PDB Compounds: (D:) Lipocalin-1

SCOPe Domain Sequences for d3eycd_:

Sequence, based on SEQRES records: (download)

>d3eycd_ b.60.1.1 (D:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
vsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlektd
epgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfek
aagarglstesiliprqsetcs

Sequence, based on observed residues (ATOM records): (download)

>d3eycd_ b.60.1.1 (D:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
vsgtwylkamtvdrefnlesvtpmtlttleggnleakvtmlisgrcqevkavlektdepg
kytadggkhvayiirshvkdhyifysegelkpvrgvklvgrdpknnlealedfekaagar
glstesiliprqsetcs

SCOPe Domain Coordinates for d3eycd_:

Click to download the PDB-style file with coordinates for d3eycd_.
(The format of our PDB-style files is described here.)

Timeline for d3eycd_: