SCOPe 2.06: Domain d3eycb_: 3eyc B:

Lineage for d3eycb_ (3eyc B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Von Ebner's gland protein (VEGP, tear lipocalin) [117265] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117266] (2 PDB entries)
   Uniprot P31025 30-168

8. Domain d3eycb_: 3eyc B: [175306]
   automated match to d1xkia_
   complexed with bu1

Details for d3eycb_

PDB Entry: 3eyc, 2.6 Å

PDB Description: new crystal structure of human tear lipocalin in complex with 1,4- butanediol in space group p21

PDB Compounds: (B:) Lipocalin-1

SCOPe Domain Sequences for d3eycb_:

Sequence, based on SEQRES records:

>d3eycb_ b.60.1.1 (B:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlekt
depgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfe
kaagarglstesiliprqsetcs

Sequence, based on observed residues (ATOM records):

>d3eycb_ b.60.1.1 (B:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
dvsgtwylkamtvdrefpemnlesvtpmtlttlnleakvtmlisgrcqevkavlektdep
gkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfekaa
garglstesiliprqsetcs

Timeline for d3eycb_:

• d3eycb_ first appeared in SCOPe 2.01
  
• d3eycb_ appears in SCOPe 2.05
  
• d3eycb_ appears in SCOPe 2.07
  
• d3eycb_ appears in the current release, SCOPe 2.08