SCOPe 2.06: Domain d3eyca_: 3eyc A:

Lineage for d3eyca_ (3eyc A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Von Ebner's gland protein (VEGP, tear lipocalin) [117265] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117266] (2 PDB entries)
   Uniprot P31025 30-168

8. Domain d3eyca_: 3eyc A: [175305]
   automated match to d1xkia_
   complexed with bu1

Details for d3eyca_

PDB Entry: 3eyc, 2.6 Å

PDB Description: new crystal structure of human tear lipocalin in complex with 1,4- butanediol in space group p21

PDB Compounds: (A:) Lipocalin-1

SCOPe Domain Sequences for d3eyca_:

Sequence; same for both SEQRES and ATOM records:

>d3eyca_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}
vsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlektd
epgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfek
aagarglstesiliprqsetcsp

Timeline for d3eyca_:

• d3eyca_ first appeared in SCOPe 2.01
  
• d3eyca_ appears in SCOPe 2.05
  
• d3eyca_ appears in SCOPe 2.07
  
• d3eyca_ appears in the current release, SCOPe 2.08