Class b: All beta proteins [48724] (177 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Von Ebner's gland protein (VEGP, tear lipocalin) [117265] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117266] (2 PDB entries) Uniprot P31025 30-168 |
Domain d3eyca_: 3eyc A: [175305] automated match to d1xkia_ complexed with bu1 |
PDB Entry: 3eyc (more details), 2.6 Å
SCOPe Domain Sequences for d3eyca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eyca_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]} vsgtwylkamtvdrefpemnlesvtpmtlttleggnleakvtmlisgrcqevkavlektd epgkytadggkhvayiirshvkdhyifysegelhgkpvrgvklvgrdpknnlealedfek aagarglstesiliprqsetcsp
Timeline for d3eyca_: