SCOPe 2.05: Domain d3exya_: 3exy A:

Lineage for d3exya_ (3exy A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
   contains two 4Fe-4S clusters

6. Protein automated matches [190638] (3 species)
   not a true protein

7. Species Allochromatium vinosum [TaxId:1049] [188869] (2 PDB entries)

8. Domain d3exya_: 3exy A: [175302]
   automated match to d1blua_
   complexed with sf4

Details for d3exya_

PDB Entry: 3exy, 1.48 Å

PDB Description: crystal structure of the 2[4fe-4s] ferredoxin v13g variant from allochromatium vinosum

PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3exya_:

Sequence; same for both SEQRES and ATOM records:

>d3exya_ d.58.1.1 (A:) automated matches {Allochromatium vinosum [TaxId: 1049]}
almitdecincdgcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
dpsheetedelrakyeritge

Timeline for d3exya_:

• d3exya_ first appeared in SCOPe 2.01
  
• d3exya_ appears in SCOPe 2.04
  
• d3exya_ appears in SCOPe 2.06
  
• d3exya_ appears in the current release, SCOPe 2.08