Lineage for d3exya_ (3exy A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1203811Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 1203812Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
    contains two 4Fe-4S clusters
  6. 1203826Protein automated matches [190638] (3 species)
    not a true protein
  7. 1203827Species Allochromatium vinosum [TaxId:1049] [188869] (2 PDB entries)
  8. 1203829Domain d3exya_: 3exy A: [175302]
    automated match to d1blua_
    complexed with sf4

Details for d3exya_

PDB Entry: 3exy (more details), 1.48 Å

PDB Description: crystal structure of the 2[4fe-4s] ferredoxin v13g variant from allochromatium vinosum
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3exya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exya_ d.58.1.1 (A:) automated matches {Allochromatium vinosum [TaxId: 1049]}
almitdecincdgcepecpngaisqgdetyviepslctecvghyetsqcvevcpvdciik
dpsheetedelrakyeritge

SCOPe Domain Coordinates for d3exya_:

Click to download the PDB-style file with coordinates for d3exya_.
(The format of our PDB-style files is described here.)

Timeline for d3exya_: