Lineage for d3exrb_ (3exr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079149Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species)
  7. 2079178Species Streptococcus mutans [TaxId:1309] [188972] (3 PDB entries)
  8. 2079180Domain d3exrb_: 3exr B: [175294]
    automated match to d1kv8b_

Details for d3exrb_

PDB Entry: 3exr (more details), 1.7 Å

PDB Description: Crystal structure of KGPDC from Streptococcus mutans
PDB Compounds: (B:) RmpD (Hexulose-6-phosphate synthase)

SCOPe Domain Sequences for d3exrb_:

Sequence, based on SEQRES records: (download)

>d3exrb_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Streptococcus mutans [TaxId: 1309]}
qlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdkiiva
dtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelygdwt
ydqaqqwldagisqaiyhqsrdallagetwgekdlnkvkkliemgfrvsvtgglsvdtlk
lfegvdvftfiagrgiteaknpagaarafkdeikriwg

Sequence, based on observed residues (ATOM records): (download)

>d3exrb_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Streptococcus mutans [TaxId: 1309]}
qlpnlqvaldhsnlkgaitaavsvgnevdvieagtvcllqvgselvevlrslfpdkiiva
dtkcadaggtvaknnavrgadwmtcicsatiptmkaarkaiedinpdkgeiqvelygdwt
ydqaqqwldagisqaiyhqsretwgekdlnkvkkliemgfrvsvtgglsvdtlklfegvd
vftfiagrgiteaknpagaarafkdeikriwg

SCOPe Domain Coordinates for d3exrb_:

Click to download the PDB-style file with coordinates for d3exrb_.
(The format of our PDB-style files is described here.)

Timeline for d3exrb_: