SCOPe 2.04: Domain d3exla_: 3exl A:

Lineage for d3exla_ (3exl A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187745] (7 PDB entries)

8. Domain d3exla_: 3exl A: [175291]
   automated match to d1hu8a_
   protein/DNA complex; protein/RNA complex; complexed with flc, zn

Details for d3exla_

PDB Entry: 3exl, 2.2 Å

PDB Description: crystal structure of a p53 core tetramer bound to dna

PDB Compounds: (A:) mouse p53 core domain

SCOPe Domain Sequences for d3exla_:

Sequence; same for both SEQRES and ATOM records:

>d3exla_ b.2.5.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qktyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvra
maiykksqhmtevvrrcphhercsdgdglappqhlirvegnlypeyledrqtfrhsvvvp
yeppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpg
rdrrteeenfrkke

Timeline for d3exla_:

• d3exla_ first appeared in SCOPe 2.01
  
• d3exla_ appears in SCOPe 2.03
  
• d3exla_ appears in SCOPe 2.05
  
• d3exla_ appears in the current release, SCOPe 2.08