| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
| Protein automated matches [190198] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187745] (7 PDB entries) |
| Domain d3exjb_: 3exj B: [175290] automated match to d1hu8a_ protein/DNA complex; protein/RNA complex; complexed with flc, zn |
PDB Entry: 3exj (more details), 2 Å
SCOPe Domain Sequences for d3exjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exjb_ b.2.5.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sqktyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvr
amaiykksqhmtevvrrcphhercsdgdglappqhlirvegnlypeyledrqtfrhsvvv
pyeppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacp
grdrrteeenfrkk
Timeline for d3exjb_: